missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DEC2/SHARP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-58737-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
DEC2/SHARP1 Polyclonal specifically detects DEC2/SHARP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spécification
| DEC2/SHARP1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| basic helix-loop-helix domain containing, class B, 3, basic helix-loop-helix family, member e41, bHLHb3, BHLHB3class E basic helix-loop-helix protein 41, bHLHe41, Class B basic helix-loop-helix protein 3, DEC2Enhancer-of-split and hairy-related protein 1, Differentially expressed in chondrocytes protein 2, SHARP-1, SHARP1hDEC2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 79365 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| BHLHE41 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLY | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu