DNA Polymerase Kappa Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque: Novus Biologicals NBP2-57385

Code nomenclature Nacres: NA.46

Afficher plus de versions de ce produit

Code produit. 18264515

589.00€ / 100µL

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

DNA Polymerase Kappa Polyclonal specifically detects DNA Polymerase Kappa in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifikationer

Antigène	DNA Polymerase Kappa
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Alias de gène	DINB protein, DINPPOLQDINB1EC 2.7.7.7, DNA polymerase kappa, polymerase (DNA directed) kappa
Espèces hôtes	Rabbit
Méthode de purification	Affinity Purified
État réglementaire	RUO
Identification génétique (Entrez)	51426
Espèces cibles	Human
Isotype	IgG

Applications	Immunocytochemistry, Immunofluorescence
Conjugué	Unconjugated
Formule	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Symboles de gène(s)	POLK
Immunogène	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQL
Quantité	100 μL
Primaire ou secondaire	Primary
Spécificité du test	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Contenu et stockage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Produktförslag

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Ditt namn

E-postadress *

Typ av ärende *

Detaljerad beskrivning av ärendet/förfrågan *

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Avbryt Skicka in

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.

For Research Use Only

Hittar du en möjlighet till förbättring?Dela en innehållskorrigering

DNA Polymerase Kappa Antibody, Novus Biologicals™

Description

Specifikationer

Produktförslag

Dokument

Kampanjer