missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. Dynactin Subunit 2/DCTN2/DCTN-50 Antibody, Novus Biologicals™

Dynactin Subunit 2/DCTN2/DCTN-50 Antibody, Novus Biologicals™

Code produit 18486721 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
25ul
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18486721 25ul 25µL
18283238 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18486721 Fournisseur Novus Biologicals Code fournisseur NBP18527725ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody has been used in 1 publication

Dynactin Subunit 2/DCTN2/DCTN-50 Polyclonal specifically detects Dynactin Subunit 2/DCTN2/DCTN-50 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
TRUSTED_SUSTAINABILITY

Spécification

Antigène Dynactin Subunit 2/DCTN2/DCTN-50
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène DCTN-50, DCTN5050 kD dynein-associated polypeptide, dynactin 2 (p50), dynactin complex 50 kD subunit, Dynactin complex 50 kDa subunit, dynactin subunit 2,50 kDa dynein-associated polypeptide, DYNAMITIN, p50 dynamitin, RBP50
Symboles de gène(s) DCTN2
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL
Méthode de purification Affinity Purified
Quantité 25ul
État réglementaire RUO
Disciplines de recherche Cell Cycle and Replication
Primaire ou secondaire Primary
Identification génétique (Entrez) 10540
Spécificité du test Specificity of human Dynactin Subunit 2/DCTN2/DCTN-50 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.