missing translation for 'onlineSavingsMsg'
Learn More
Learn More
eIF2B epsilon Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-56363-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
eIF2B epsilon Polyclonal specifically detects eIF2B epsilon in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spécification
| eIF2B epsilon | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| CACH, CLE, EIF-2B, eIF-2B GDP-GTP exchange factor subunit epsilon, EIF2BE, EIF2Bepsilon, eukaryotic translation initiation factor 2B, subunit 5 (epsilon, 82kD), eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa, LVWM, translation initiation factor eIF-2B subunit epsilon | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| EIF2B5 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLL | |
| 25 μL | |
| DNA Repair, DNA replication Transcription Translation and Splicing | |
| 8893 | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu