ENPP-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque: Novus Biologicals NBP2-38945

Code nomenclature Nacres: NA.46

Afficher plus de versions de ce produit

Code produit. 18145609

593.00€ / 0.10mL

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

ENPP-1 Polyclonal specifically detects ENPP-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Spécification

Antigène	ENPP-1
Classification	Polyclonal
Dilution	Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Numéro d’ordre du gène	P22413
Symboles de gène(s)	ENPP1
Immunogène	This antibody was developed against a recombinant protein corresponding to amino acids: GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC
Quantité	0.1 mL
Disciplines de recherche	Lipid and Metabolism
Identification génétique (Entrez)	5167
Espèces cibles	Human
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugué	Unconjugated
Formule	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène	ectonucleotide pyrophosphatase/phosphodiesterase 1, E-NPP 1, Ly-41 antigen, M6S1NPP1, Membrane component chromosome 6 surface marker 1, membrane component, chromosome 6, surface marker 1, NPPSalkaline phosphodiesterase 1, PC1, PC-1, PCA1ARHR2, PDNP1ectonucleotide pyrophosphatase/phosphodiesterase family member 1, Phosphodiesterase I/nucleotide pyrophosphatase 1, plasma-cell membrane glycoprotein 1, Plasma-cell membrane glycoprotein PC-1
Espèces hôtes	Rabbit
Méthode de purification	Affinity Purified
État réglementaire	RUO
Primaire ou secondaire	Primary
Spécificité du test	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Contenu et stockage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Suggestions de produits

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

Votre nom

Votre adresse e-mail *

Type de problème *

Description détaillée du problème/de la demande *

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Annuler Soumettre

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis

Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu

ENPP-1 Antibody, Novus Biologicals™

Description

Spécification

Suggestions de produits

Documents

Promotions