missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ENT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP1-85253
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
ENT2 Polyclonal specifically detects ENT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
| Polyclonal | |
| Delayed-early response protein 12, DER12Solute carrier family 29 member 2, ENT2, Equilibrative NBMPR-insensitive nucleoside transporter, Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleosidetransporter, equilibrative nucleoside transporter 2, HNP3636 kDa nucleolar protein HNP36, Hydrophobic nucleolar protein, 36 kDa, hydrophobic nucleolar protein, 36kD, Nucleoside transporter, ei-type, solute carrier family 29 (nucleoside transporters), member 2 | |
| 0.1 mL | |
| IgG |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQK | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu