missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ETS1 associated protein II Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 624.00€
Spécification
| Antigène | ETS1 associated protein II |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Espèces hôtes | Rabbit |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18276292
|
Novus Biologicals
NBP2-55948 |
100 μL |
624.00€
100µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18688808
|
Novus Biologicals
NBP2-55948-25ul |
25 μL |
280.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
ETS1 associated protein II Polyclonal specifically detects ETS1 associated protein II in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spécification
| ETS1 associated protein II | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction, Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 51567 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| AD022, dJ30M3.3, EAP2, EAPII, EC 3.1.4.-, ETS1-associated protein 2, ETS1-associated protein II, MGC111021,5'-Tyr-DNA phosphodiesterase, MGC9099,5'-tyrosyl-DNA phosphodiesterase, TRAF and TNF receptor associated protein, TTRAPTRAF and TNF receptor-associated protein, Tyr-DNA phosphodiesterase 2, tyrosyl-DNA phosphodiesterase 2 | |
| TDP2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit