missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 18396909

FASTK Antibody (2B7), Novus Biologicals™

Code produit 18396909 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mg
Conditionnement:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18396909 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18396909 Fournisseur Novus Biologicals Code fournisseur H00010922M02

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Mouse Monoclonal Antibody

FASTK Monoclonal antibody specifically detects FASTK in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Spécification

Antigène FASTK
Applications Western Blot, ELISA, Immunocytochemistry
Classification Monoclonal
Clone 2B7
Conjugué Unconjugated
Dilution Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence
Formule In 1x PBS, pH 7.4
Numéro d’ordre du gène NP_006703
Alias de gène EC 2.7.11.8, Fas-activated serine/threonine kinase, FASTFAST kinase
Espèces hôtes Mouse
Immunogène FASTK (NP_006703, 67 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KWGDRPVGGGPSAGPVQGLQRLLEQAKSPGELLRWLGQNPSKVRAHHYSVALRRLGQLLGSRPRPPPVEQVTLQDLSQLIIRNCPSFD
Méthode de purification IgG purified
Quantité 0.1 mg
État réglementaire RUO
Disciplines de recherche Apoptosis
Primaire ou secondaire Primary
Identification génétique (Entrez) 10922
Espèces cibles Human
Contenu et stockage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG2a κ
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.