missing translation for 'onlineSavingsMsg'
Learn More

FERMT3/URP2 Antibody, Novus Biologicals™

Code produit 18277194 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
25 μL
Conditionnement:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18277194 100 μL 100µL
18638347 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18277194 Fournisseur Novus Biologicals Code fournisseur NBP257110

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

FERMT3/URP2 Polyclonal specifically detects FERMT3/URP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Spécification

Antigène FERMT3/URP2
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formule PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gène fermitin family member 3, KIND3fermitin family homolog 3 (Drosophila), kindlin 3, Kindlin-3, MGC10966, MIG-2, MIG2BURP2SF, MIG2-like protein, UNC-112 related protein 2, UNC112C, Unc-112-related protein 2, URP2fermitin family homolog 3
Symboles de gène(s) FERMT3
Espèces hôtes Rabbit
Immunogène This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLT
Méthode de purification Affinity Purified
Quantité 100 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 83706
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.