missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FKBP11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP1-84678-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
FKBP11 Polyclonal specifically detects FKBP11 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spécification
| FKBP11 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| 19 kDa FK506-binding protein, EC 5.2.1.8, FK506 binding protein 11, 19 kDa, FK506-binding protein 11, FKBP-11, FKBP-19, FKBP19FK506 binding protein 11 (19 kDa), MGC54182,19 kDa FKBP, peptidyl-prolyl cis-trans isomerase FKBP11, PPIase FKBP11, rotamase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 51303 | |
| Human, Mouse | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FKBP11 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG | |
| 25 μL | |
| Primary | |
| Specificity of SFKBP11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu