missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FPGT (Human) Recombinant Protein

Human FPGT full-length ORF ( NP_003829.2, 1 a.a. - 594 a.a.) recombinant protein with GST-tag at N-terminal.

335.00€ - 508.00€

Numéro d’adhésion	NP_003829.2
Identification génétique (Entrez)	8790
Nom	fucose-1-phosphate guanylyltransferase
Méthode de préparation	Wheat germ expression system
Test du contrôle qualité	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantité	Price	Quantity & Availability
Product Code	Brand	Quantité	Price	Quantity & Availability
16142902 missing translation for 'viewDocuments' Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00008790-P01.10UG	10 μg	335.00€ 10µg View alternative products missing translation for 'toSaveUpto' »	Expédition estimée: 20-06-2024 Connectez-vous pour voir le stock disponible	Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

16152902 missing translation for 'viewDocuments' Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00008790-P01.25UG	25 μg	508.00€ 25µg View alternative products missing translation for 'toSaveUpto' »	Expédition estimée: 20-06-2024 Connectez-vous pour voir le stock disponible	Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Description

Sequence: MAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADEKQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALQCLEKLYGDKWNSFTILLIHSGGYSQRLPNASALGKIFTALPLGNPIYQMLELKLAMYIDFPLNMNPGILVTCADDIELYSIGEFEFIRFDKPGFTALAHPSSLTIGTTHGVFVLDPFDDLKHRDLEYRSCHRFLHKPSIEKMYQFNAVCRPGNFCQQDFAGGDIADLKLDSDYVYTDSLFYMDHKSAKMLLAFYEKIGTLSCEIDAYGDFLQALGPGATVEYTRNTSNVIKEESELVEMRQRIFHLLKGTSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIPECSGKTSCIIQSILDSRCSVAPGSVVEYSRLGPDVSVGENCIISGSYILTKAALPAHSFVCSLSLKMNRCLKYATMAFGVQDNLKKSVKTLSDIKLLQFFGVCFLSCLDVWNLKVTEELFSGNKTCLSLWTARIFPVCSSLSDSVITSLKMLNAVKNKSAFSLNSYKLLSIEEMLIYKDVEDMITYREQIFLEISLKSSLM

Specifications

Numéro d’adhésion	NP_003829.2
Nom	fucose-1-phosphate guanylyltransferase
Test du contrôle qualité	125% SDS-PAGE Stained with Coomassie Blue
Alias de gène	GFPP
Espèces	Wheat Germ (in vitro)
Tampon	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Identification génétique (Entrez)	8790
Méthode de préparation	Wheat germ expression system
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Symbole de gène(s)	FPGT
Marqueur de protéine	GST

Description