missing translation for 'onlineSavingsMsg'
Learn More
Learn More
G gamma14 Antibody (1G11-C7), Novus Biologicals™
Mouse Monoclonal Antibody
Marque: Novus Biologicals H00002793-M01
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
G gamma14 Monoclonal antibody specifically detects G gamma14 in Human samples. It is validated for Western Blot, ELISA, ELISA
Spécification
| G gamma14 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| G protein cone gamma 8 subunit, gamma-T2 subunit, G-GAMMA-8, G-gamma-9, G-GAMMA-C, GNG8, GNG9G gamma-C, GNGT8, guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 2, guanine nucleotide binding protein gamma 9, Guanine nucleotide binding protein gamma transducing activity polypeptide 2, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 | |
| GNGT2 (AAH08663, 1 a.a. ~ 69 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS | |
| 0.1 mg | |
| Signal Transduction | |
| 2793 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
| Western Blot, ELISA, Sandwich ELISA | |
| 1G11-C7 | |
| Western Blot 1:500, ELISA, Sandwich ELISA | |
| AAH08663 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu