missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GADD153/CHOP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 559.00€
Spécification
| Antigène | GADD153/CHOP |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18644158
|
Novus Biologicals
NBP2-49550-25ul |
25 μL |
369.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18634977
|
Novus Biologicals
NBP2-49550 |
0.1 mL |
559.00€
0.10mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
GADD153/CHOP Polyclonal antibody specifically detects GADD153/CHOP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Spécification
| GADD153/CHOP | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cell Cycle and Replication, DNA Repair, Hypoxia, Lipid and Metabolism, Neuroscience, Unfolded Protein Response | |
| PBS (pH 7.2), 40% Glycerol | |
| 1649 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| C/EBP-homologous protein, C/EBP-homologous protein 10, CCAAT/enhancer-binding protein homologous protein, CHOP-10, CHOP10 CEBPZ, CHOPC/EBP zeta, DDIT-3, DNA damage-inducible transcript 3 protein, DNA-damage-inducible transcript 3, GADD153, Growth arrest and DNA damage-inducible protein GADD153 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit