missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GAPDH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-48721-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
GAPDH Polyclonal antibody specifically detects GAPDH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Spécification
| GAPDH | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated | |
| aging-associated gene 9 protein, EC 1.2.1, EC 1.2.1.12, EC 2.6.99.-, G3PD, GAPD, glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, MGC88685, Peptidyl-cysteine S-nitrosylase GAPDH | |
| This GAPDH antibody was developed against a recombinant protein corresponding to amino acids: TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS | |
| 25 μL | |
| Alzheimers Research, Apoptosis, Autophagy, Cancer, DNA Repair, Lipid and Metabolism, Loading Controls, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Nuclear Receptors Coactivators and Corepressors, Signal Transduction, Translation Control | |
| 2597 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu