missing translation for 'onlineSavingsMsg'
Learn More

GDF-15 Antibody, Novus Biologicals™

Code produit 18447830 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
25ul
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18447830 25ul 25µL
18751534 - 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18447830 Fournisseur Novus Biologicals Code fournisseur NBP18105025ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody has been used in 9 publications

GDF-15 Polyclonal specifically detects GDF-15 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Knockdown Validated.
TRUSTED_SUSTAINABILITY

Spécification

Antigène GDF-15
Applications Immunoprecipitation, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunoprecipitation Reactivity reported in (PMID: 26114631)., Immunohistochemistry-Paraffin 1:50 - 1:200
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Numéro d’ordre du gène Q99988
Alias de gène growth differentiation factor 15, growth/differentiation factor 15, Macrophage inhibitory cytokine 1, MIC-1NSAID-activated gene 1 protein, MIC1Prostate differentiation factor, NAG-1NSAID-regulated gene 1 protein, NSAID (nonsteroidal inflammatory drug)-activated protein 1, PDFGDF-15, PLABNRG-1, Placental bone morphogenetic protein, Placental TGF-beta, PTGFBPTGF-beta
Symboles de gène(s) GDF15
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL
Poids moléculaire de l’antigène 34 kDa
Méthode de purification Affinity Purified
Quantité 25ul
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 9518
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.