missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GLMN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-14056-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
GLMN Polyclonal antibody specifically detects GLMN in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Spécification
| GLMN | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| FAP, FAP48FAP68, FKBPAP, GLMLFK506-binding protein-associated protein, glomulin, glomulin, FKBP associated protein, GVM, GVMFKBP-associated protein, VMGLOMvenous malformation with glomus cells | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: LSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESV | |
| 25 μL | |
| Angiogenesis | |
| 11146 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu