missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. GMPS Antibody, Novus Biologicals™

GMPS Antibody, Novus Biologicals™

Code produit 18292375 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18292375 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18292375 Fournisseur Novus Biologicals Code fournisseur NBP152972

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

GMPS Polyclonal specifically detects GMPS in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigène GMPS
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugué Unconjugated
Dilution Western Blot 1.0 ug/ml
Formule PBS, 2% Sucrose with 0.09% Sodium Azide
Numéro d’ordre du gène P49915
Alias de gène EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein
Symboles de gène(s) GMPS
Espèces hôtes Rabbit
Immunogène Synthetic peptides corresponding to GMPS(guanine monphosphate synthetase) The peptide sequence was selected from the middle region of GMPS. Peptide sequence VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA.
Poids moléculaire de l’antigène 77 kDa
Méthode de purification Affinity purified
Quantité 100 μL
État réglementaire RUO
Disciplines de recherche metabolism
Primaire ou secondaire Primary
Identification génétique (Entrez) 8833
Spécificité du test Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 92%; Zebrafish: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Espèces cibles Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.