missing translation for 'onlineSavingsMsg'
Learn More

GPBP1L1 Antibody, Novus Biologicals™

Code produit p-200048222 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
25ul
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18417180 25ul 25µL
18230376 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18417180 Fournisseur Novus Biologicals Code fournisseur NBP18073325ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

GPBP1L1 Polyclonal specifically detects GPBP1L1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigène GPBP1L1
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène GC-rich promoter binding protein 1-like 1, GC-rich promoter-binding protein 1-like 1, RP11-767N6.1, SP192, vasculin-like protein 1
Symboles de gène(s) GPBP1L1
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:GMSQRSGGGTGNHRHWNGSFHSRKGCAFQEKPPMEIREEKKEDKVEKLQFEEEDFPSLNPEAGKQHQPCRPIGTPSGVWENPPSAKQP
Méthode de purification Affinity Purified
Quantité 25ul
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 60313
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.