missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 30498619

Hemoglobin beta Antibody [PerCP], Novus Biologicals Biologicals™

Code produit 30498619 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité
30498619 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30498619 Fournisseur Novus Biologicals Code fournisseur NBP335330PCP

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

Hemoglobin beta Polyclonal antibody specifically detects Hemoglobin beta in Human,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Spécification

Antigène Hemoglobin beta
Applications ELISA, Western Blot
Classification Polyclonal
Conjugué PerCP
Formule PBS
Alias de gène beta globin chain, beta-globin, CD113t-C, HBBB, HBD, Hemoglobin beta chain, hemoglobin subunit beta, hemoglobin, beta
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence within amino acids 47-147 of human Hemoglobin beta (NP_000509.1).,, Sequence:, GDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 3043
Espèces cibles Human, Rat
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.