missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HLA DPB1 Antibody [DyLight 680], Novus Biologicals Biologicals™
Tous les produits Bio Techne ProduitsDescription
HLA DPB1 Polyclonal antibody specifically detects HLA DPB1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Spécification
Spécification
| Antigène | HLA DPB1 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | DyLight 680 |
| Formule | 50mM Sodium Borate |
| Alias de gène | DP beta 1 chain, DPB1, HLA class II histocompatibility antigen, DP(W4) beta chain, HLA DP14-beta chain, HLA-DP histocompatibility type, beta-1 subunit, HLA-DP1B, HLA-DPB, major histocompatibility complex class II HLA DPB1 protein, major histocompatibility complex, class II, DP beta 1, MHC class II antigen beta chain, MHC class II antigen DP beta 1 chain, MHC class II antigen DPB1, MHC class II antigen DPbeta1, MHC class II HLA-DP-beta, MHC HLA DPB1 |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 40-100 of human HLA DPB1 (NP_002112.3).,, Sequence:, GRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRA |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Privatlivspolitik.
Ser du en mulighed for forbedring?