missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ALDH1A1 Partial ORF (AAH01505, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque:  Abnova™ H00000216-Q01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16151451

  • 545.00€ / 25µg
Expédition estimée: 03-08-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes. [provided by RefSeq]

Sequence: MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMN
Spécification

Spécification

AAH01505
Liquid
216
ALDH1A1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ALDC/ALDH-E1/ALDH1/ALDH11/MGC2318/PUMB1/RALDH1
ALDH1A1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.51kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMN
RUO
ALDH1A1
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents
Certificats
Promotions

Promotions