missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ALDH1A1 Partial ORF (AAH01505, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

359.00€ - 545.00€

Spécification

Nom ALDH1A1 (Human) Recombinant Protein (Q01)
Recombinant Yes
À utiliser avec (application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Poids moléculaire 37.51kDa
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Consulter d'autres spécifications

Produits 2
Code produit Marque Quantité Prix Quantité et disponibilité  
Code produit Marque Quantité Prix Quantité et disponibilité  
16151451
Afficher les documents Détails de la promotion
Abnova™
H00000216-Q01.25UG
25 ug
545.00€
25µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 02-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
16141451
Afficher les documents Détails de la promotion
Abnova™
H00000216-Q01.10UG
10 ug
359.00€
10µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 02-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
Description

Description

This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes. [provided by RefSeq]

Sequence: MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMN
Spécification

Spécification

ALDH1A1 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
37.51kDa
FDS
Product Certifications