missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human BATF Partial ORF (NP_006390, 34 a.a. - 125 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00010538-Q01.25ug
Additional Details : Poids : 0.00010kg
Description
The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq]
Sequence: EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQPSpecifications
| NP_006390 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.86kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP | |
| RUO | |
| BATF | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 10538 | |
| BATF (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| B-ATF/BATF1/SFA-2/SFA2 | |
| BATF | |
| Recombinant | |
| wheat germ expression system |