missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CCRK Partial ORF (AAH02655.1, 183 a.a. - 257 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque:  Abnova™ H00023552-Q01.25ug

Informations supplémentaires : Poids : 0.02000kg

 Afficher plus de versions de ce produit

Code produit. 16005375

  • 545.00€ / 25µg
Expédition estimée: 09-08-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase activates CDK2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Sequence: FPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIA
Spécification

Spécification

AAH02655.1
Liquid
23552
CCRK (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CDCH/p42
CCRK
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.88kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
FPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIA
RUO
CCRK
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents
Certificats
Promotions

Promotions