missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human LIX1 (aa 110-156) Control Fragment Recombinant Protein Code produit.: 30195741
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30195741

Invitrogen™ Human LIX1 (aa 110-156) Control Fragment Recombinant Protein

Code produit. 30195741
100 μl, 100µL
Code nomenclature Nacres: NA.28
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30195741

Marque: Invitrogen™ RP101817

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63571 (PA5-63571. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The specific function of this protein remains unknown.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q8N485
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 167410
Nom Human LIX1 (aa 110-156) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 5730466L18Rik; C5orf11; Lft; limb and CNS expressed 1; limb expression 1; limb expression 1 homolog; limb expression 1 homolog (chicken); Li x 1; Li x 1 homolog; Li x 1 homolog (chicken); Lowfat homolog; protein limb expression 1 homolog
Nom usuel LIX1
Symbole de gène(s) LIX1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence RRITKEFIMESVQEAVASTSGTLDDADDPSTSVGAYHYMLESNMGKT
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins

Suggestions de produits

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit
Invitrogen™ Human LIX1 (aa 110-156) Control Fragment Recombinant Protein >

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis