missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human MS4A2 Full-length ORF (NP_000130.1, 1 a.a. - 244 a.a.) Recombinant Protein with GST-tag at N-terminal Code produit.: 16144881

Abnova™ Human MS4A2 Full-length ORF (NP_000130.1, 1 a.a. - 244 a.a.) Recombinant Protein with GST-tag at N-terminal

Code produit. 16144881
10 ug, 10µg
Code nomenclature Nacres: NA.28
Click to view available options
Quantité:
10 ug
25 ug
Conditionnement:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 16144881

Marque: Abnova™ H00002206P01.10ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Used for AP, Array, ELISA, WB-Re

The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of family members. Alternative splicing results in multiple transcript variants encoding different isoforms

Sequence: MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL

Spécification

Numéro d’adhésion NP_000130.1
À utiliser avec (application) Antibody Production, Protein Array, ELISA, Western Blot
Formule 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Identification génétique (Entrez) 2206
Poids moléculaire 52.9kDa
Nom MS4A2 (Human) Recombinant Protein (P01)
Méthode de purification Glutathione Sepharose 4 Fast Flow
Test du contrôle qualité 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantité 10 ug
Immunogène MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
État réglementaire RUO
Alias de gène APY/ATOPY/FCER1B/FCERI/IGEL/IGER/IGHER/MS4A1
Nom usuel MS4A2
Symbole de gène(s) MS4A2
Espèces Wheat Germ (in vitro)
Recombinant Recombinant
Marqueur de protéine GST
Système d’expression wheat germ expression system
Forme Liquid
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts
Abnova™ Human MS4A2 Full-length ORF (NP_000130.1, 1 a.a. - 244 a.a.) Recombinant Protein with GST-tag at N-terminal >

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt