Learn More
Abnova™ Human MS4A2 Full-length ORF (NP_000130.1, 1 a.a. - 244 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of family members. Alternative splicing results in multiple transcript variants encoding different isoforms
Spécification
Spécification
Numéro d’adhésion | NP_000130.1 |
À utiliser avec (application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Identification génétique (Entrez) | 2206 |
Poids moléculaire | 52.9kDa |
Nom | MS4A2 (Human) Recombinant Protein (P01) |
Méthode de purification | Glutathione Sepharose 4 Fast Flow |
Test du contrôle qualité | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quantité | 10 ug |
Immunogène | MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL |
Mehr anzeigen |
Produktvorschläge
Clients qui ont consulté cet article ont également consulté
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.