missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PGK2 Partial ORF (NP_620061, 268 a.a. - 339 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque:  Abnova™ H00005232-Q01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16152705

  • 545.00€ / 25µg
Expédition estimée: 11-07-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

The PGK2 gene encodes a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. See also PGK1 (MIM 311800), which is ubiquitously expressed in all somatic tissues and maps to chromosome Xq13.[supplied by OMIM]

Sequence: DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGP
Spécification

Spécification

NP_620061
Liquid
5232
PGK2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PGK-2/PGKB/PGKPS/dJ417L20.2
PGK2
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.66kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGP
RUO
PGK2
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents
Certificats
Promotions

Promotions