missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human SIRP alpha (aa 448-504) Control Fragment Recombinant Protein Code produit.: 30198966

Invitrogen™ Human SIRP alpha (aa 448-504) Control Fragment Recombinant Protein

Code produit. 30198966
100 μl, 100µL
Code nomenclature Nacres: NA.28
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30198966

Marque: Invitrogen™ RP106541

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SIRP alpha (CD172a, signal-regulatory protein alpha) is a receptor-type transmembrane glycoprotein expressed on cells of myeloid origin, including granulocytes, dendritic cells (DCs), macrophages, mast cells and hematopoietic stem cells. SIRP alpha acts as a substrate for several activated tyrosine kinases, including EGFR, PDGFR, src and insulin receptor and is involved in the negative regulation of receptor tyrosine kinase-coupled signaling pathways. The ligand binding of SIRP alpha to integrin-associated protein CD47 results in tyrosine kinase phosphorylation of immunoreceptor tyrosine-based inhibitory motifs (ITIMs) within the cytoplasmic region of SIRP alpha, which mediates the recruitment and activation of the tyrosine phosphatases SHP-1 and SHP-2. Ligation of SIRP alpha with CD47 has been demonstrated in several regulatory processes, including the inhibition of host cell phagocytosis by macrophages and the bi-directional activation of T cells and DCs. SIRP alpha has regulatory effects on cellular responses induced by serum, growth factors, insulin, oncogenes, growth hormones and cell adhesion, and plays a general role in different physiological and pathological processes. Cancer cells highly express CD47, which activates SIRP alpha and inhibits macrophage-mediated destruction of cancerous cell growth.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P78324
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 140885
Nom Human SIRP alpha (aa 448-504) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène AI835480; Bit; brain Ig-like molecule with tyrosine-based activation motifs; Brain immunoglobulin like protein with tyrosine - based activation motifs; brain immunological-like with tyrosine-based motifs; brain-immunoglobulin-like molecule with tyrosine-based activation motifs; CD172; CD172 alpha; CD172 antigen-like family member A; CD172A; Inhibitory receptor SHPS-1; macrophage fusion receptor; Macrophage membrane protein MFP150; MFR; mSIRP-alpha1; Myd1; MYD-1; myD-1 antigen; p84; Protein tyrosine phosphatase non-receptor type substrate 1 (SHP substrate 1); protein tyrosine phosphatase, non-receptor type substrate 1; Protein tyrosine phosphatase, non-receptor type substrate 1 (SHP substrate 1); Ptpns1; SHP substrate 1; SHP-1; SHPS1; SHPS-1; signal regulatory protein alpha; signal-regulatory protein alpha; signal-regulatory protein alpha-1; Signal-regulatory protein alpha-2; Signal-regulatory protein alpha-3; SIRP; Sirpa; SIRPalpha; Sirp-alpha-1; SIRPalpha2; Sirp-alpha-2; Sirp-alpha-3; swc3; swine workshop cluster 3 antigen; swine workshop cluster 3 antigen precursor; tyrosine phosphatase SHP substrate 1; tyrosine-protein phosphatase non-receptor type substrate 1
Nom usuel SIRP alpha (CD172a)
Symbole de gène(s) SIRPA
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit
Invitrogen™ Human SIRP alpha (aa 448-504) Control Fragment Recombinant Protein >

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis