Learn More
Abnova™ Human TJAP1 Partial ORF (NP_542171.1, 77 a.a. - 180 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marque: Abnova™ H00093643-Q01.10ug
Informations supplémentaires : Poids : 0.00010kg
Description
This gene encodes a tight junction-associated protein. Incorporation of the encoded protein into tight junctions occurs at a late stage of formation of the junctions. The encoded protein localizes to the Golgi and may function in vesicle trafficking. Alternatively spliced transcript variants have been described. A related pseudogene exists on the X chromosome. [provided by RefSeq]
Sequence: LELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLIKKAEMDRKTLDWEIVELTNKLLDAKNTINKLEELNERYRLDCNPAVQLLKCNKSHFRNHKSpécification
NP_542171.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.18kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
LELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLIKKAEMDRKTLDWEIVELTNKLLDAKNTINKLEELNERYRLDCNPAVQLLKCNKSHFRNHK | |
RUO | |
TJAP1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
93643 | |
TJAP1 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DKFZp686F06131/PILT/TJP4 | |
TJAP1 | |
Recombinant | |
wheat germ expression system |