missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ IBA1 Polyclonal Antibody
GREENER_CHOICE

Code produit. 16364675 Tous les produits Thermo Scientific Produits
Change view
Click to view available options
Quantité:
100 μg
Conditionnement:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit. Quantité unitSize
16364675 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit. 16364675 Fournisseur Invitrogen™ Code fournisseur PA595409

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HEL whole cell, human THP-1 whole cell. IHC: human spleen tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Ionized calcium-binding adapter molecule 1 (IBA1), also known by its gene name AIF1, is a protein expressed predominantly by microglia in the brain and spinal cord. This protein belongs to the EF-hand calcium-binding protein family and plays a crucial role in microglial activation and migration in response to brain injury or neuroinflammation. IBA1's function is integral to microglial motility and phagocytic activity, facilitating the cellular response to pathogenic stimuli and promoting tissue homeostasis and repair in the central nervous system. IBA1 serves as a reliable marker for activated microglia in various neurological disorders, including Alzheimer's disease, Parkinson's disease, and multiple sclerosis, where increased expression correlates with disease progression and severity. The protein's structural features enable it to bind calcium ions, inducing conformational changes that activate signaling pathways essential for microglial function. Its expression is highly regulated by inflammatory cytokines, underpinning its role in neuroimmune responses. Due to its specific expression in microglia during pathological conditions, IBA1 is widely used in research as a marker to study microglial status and activity, and it remains a focal point for understanding microglial involvement in neurodegenerative diseases.
TRUSTED_SUSTAINABILITY

Spécification

Antigène IBA1
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugué Unconjugated
Formule PBS with 4mg trehalose and no preservative
Expression AIF1
Numéro d’ordre du gène P55008
Alias de gène AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific
Symboles de gène(s) AIF1
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK).
Méthode de purification Affinity chromatography
Quantité 100 μg
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 199
Espèces cibles Human
Contenu et stockage -20°C
Type de produit Antibody
Forme Lyophilized
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.