missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. ING4 Antibody, Novus Biologicals™

ING4 Antibody, Novus Biologicals™

Code produit p-200073209 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
25 μL
Conditionnement:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18214502 100 μL 100µL
18631037 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18214502 Fournisseur Novus Biologicals Code fournisseur NBP255457

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

ING4 Polyclonal specifically detects ING4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigène ING4
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formule PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gène candidate tumor suppressor p33 ING1 homolog, inhibitor of growth family, member 4, inhibitor of growth protein 4, MGC12557, my036, p29ING4brain my036 protein
Symboles de gène(s) ING4
Espèces hôtes Rabbit
Immunogène This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVH
Méthode de purification Affinity Purified
Quantité 100 μL
État réglementaire RUO
Disciplines de recherche Chromatin Research, Tumor Suppressors
Primaire ou secondaire Primary
Identification génétique (Entrez) 51147
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.