missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
INTU Polyclonal antibody specifically detects INTU in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spécification
Spécification
| Antigène | INTU |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formule | PBS (pH 7.2), 40% Glycerol |
| Alias de gène | FLJ41326, Inturned planar cell polarity effector homolog, inturned planar cell polarity effector homolog (Drosophila), KIAA1284INT, PDZ domain containing 6, PDZ domain-containing protein 6, PDZD6, PDZK6homolog of inturned |
| Espèces hôtes | Rabbit |
| Immunogène | This antibody was developed against a recombinant protein corresponding to amino acids: NDNGPVSILKHQSNQKTGVIVQQRYKDVNVYVNPKKLTVIKAKEQLKLLEVLVGIIHQTKWSWRRTGKQGDGERLVVHGLLPGGSAMKSGQVLIGDV |
| Méthode de purification | Immunogen affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?