missing translation for 'onlineSavingsMsg'
Learn More

KAT2A/GCN5 Antibody [Janelia Fluor« 525], Novus Biologicals Biologicals™

Code produit 30498552 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.1 mL
Conditionnement:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30498552 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30498552 Fournisseur Novus Biologicals Code fournisseur NBP337988JF525

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

KAT2A/GCN5 Polyclonal antibody specifically detects KAT2A/GCN5 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Spécification

Antigène KAT2A/GCN5
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugué Janelia Fluor 525
Formule 50mM Sodium Borate
Alias de gène EC 2.3.1.48, GCN5 general control of amino-acid synthesis 5-like 2 (yeast), GCN5L2GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2, GCN5MGC102791, General control of amino acid synthesis protein 5-like 2, General control of amino acid synthesis, yeast, homolog-like 2, HGCN5, Histone acetyltransferase GCN5, histone acetyltransferase KAT2A, HsGCN5, K(lysine) acetyltransferase 2A, Lysine acetyltransferase 2A, PCAF-b, STAF97
Espèces hôtes Rabbit
Immunogène Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KAT2A/GCN5 (NP_066564.2).,, Sequence:, MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRA
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche DNA replication Transcription Translation and Splicing, Epigenetics, Signal Transduction
Primaire ou secondaire Primary
Identification génétique (Entrez) 2648
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.