missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
KIF13B Polyclonal specifically detects KIF13B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
Spécification
| Antigène | KIF13B |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500 |
| Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gène | GAKIN, GAKINkinesin 13B, guanylate kinase associated kinesin, KIAA0639kinesin-like protein KIF13B, kinesin family member 13B, Kinesin-like protein GAKIN |
| Symboles de gène(s) | KIF13B |
| Espèces hôtes | Rabbit |
| Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:LTGKGKLSRRSISSPNVNRLSGSRQDLIPSYSLGSNKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHSPDPGLSNLAASYLNP |
| Afficher plus |
For Research Use Only
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?