missing translation for 'onlineSavingsMsg'
Learn More

KIR2DS2 Antibody, Novus Biologicals™

Code produit p-7110635 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18089106 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18089106 Fournisseur Novus Biologicals Code fournisseur NBP198548

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

KIR2DS2 Polyclonal specifically detects KIR2DS2 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigène KIR2DS2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugué Unconjugated
Dilution Western Blot 1.0 ug/ml
Formule PBS, 2% Sucrose with 0.09% Sodium Azide
Numéro d’ordre du gène NP_036444
Alias de gène 183ActI, CD158b, CD158J, cl-49, killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2, NKAT5, p58 KIR
Symboles de gène(s) KIR2DS2
Espèces hôtes Rabbit
Immunogène The immunogen for this antibody is KIR2DS2 - N-terminal region. Peptide sequence ETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQ.
Poids moléculaire de l’antigène 32 kDa
Méthode de purification Affinity purified
Quantité 100 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 100132285
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.