missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
LARP1 Polyclonal antibody specifically detects LARP1 in Human samples. It is validated for ELISA,Western Blot
Spécification
Spécification
| Antigène | LARP1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugué | FITC |
| Formule | PBS |
| Alias de gène | KIAA0731LARPMGC19556, La ribonucleoprotein domain family member 1, La ribonucleoprotein domain family, member 1, la-related protein 1 |
| Espèces hôtes | Rabbit |
| Immunogène | Recombinant fusion protein containing a sequence corresponding to amino acids 106-205 of human LARP1 (Q6PKG0).,, Sequence:, AGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKD |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?