MASP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque: Novus Biologicals NBP1-58986

Code nomenclature Nacres: NA.46

Code produit. 18239332

484.00€ / 100µL

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

MASP2 Polyclonal specifically detects MASP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Spécification

Antigène	MASP2
Classification	Polyclonal
Conjugué	Unconjugated
Formule	PBS, 2% Sucrose with 0.09% Sodium Azide
Alias de gène	EC 3.4.21, EC 3.4.21.104, mannan-binding lectin serine peptidase 1 pseudogene 1, mannan-binding lectin serine peptidase 2, mannan-binding lectin serine protease 1 pseudogene 1, mannan-binding lectin serine protease 2, Mannose-binding protein-associated serine protease 2, MAP19, MASP1P1, MASP-2, MBL-associated plasma protein of 19 kD, MBL-associated serine protease 2, small MBL-associated protein, sMAP
Espèces hôtes	Rabbit
Poids moléculaire de l’antigène	27 kDa
Quantité	100 μL
Primaire ou secondaire	Primary
Reconstitution	Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Contenu et stockage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
Concentration	0.5 mg/ml
Dilution	Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
Numéro d’ordre du gène	O00187
Symboles de gène(s)	MASP2
Immunogène	Synthetic peptides corresponding to MASP2(mannan-binding lectin serine peptidase 2) The peptide sequence was selected from the N terminal of MASP2. Peptide sequence FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK.
Méthode de purification	Affinity purified
État réglementaire	RUO
Identification génétique (Entrez)	10747
Espèces cibles	Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish
Isotype	IgG

Suggestions de produits

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

Votre nom

Votre adresse e-mail *

Type de problème *

Description détaillée du problème/de la demande *

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Annuler Soumettre

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis

For Research Use Only

Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu

MASP2 Antibody, Novus Biologicals™

Description

Spécification

Suggestions de produits

Documents

Promotions