missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ MBP Monoclonal Antibody (7D2)

Mouse Monoclonal Antibody

Marque:  Invitrogen™ MA547468

Code nomenclature Nacres: NA.46

 Afficher plus de versions de ce produit

Code produit. 17855027

  • 491.00€ / 100µL

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Description

MBP Monoclonal Antibody for ICC/IF, IHC, Western Blot

The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called 'Golli-MBP') that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes.
TRUSTED_SUSTAINABILITY
Spécification

Spécification

MBP
Monoclonal
1 mg/mL
PBS with 50% glycerol and 5mM sodium azide
P02686, P02687, P02688, P04370, P81558, P83487
MBP
Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.
100 μL
Primary
Bovine, Horse, Human, Mouse, Pig, Rat
Antibody
IgG1
Immunohistochemistry, Western Blot, Immunocytochemistry
7D2
Unconjugated
MBP
20 kDa microtubule-stabilizing protein; C76307; golli mbp; Golli-mbp; Golli-MBP; myelin basic protein; Golli-Mbp; myelin basic protein; myelin basic protein S; Hmbpr; MBP; MBP S; Mbps; MGC99675; microtubule-stabilizing protein; mld; MOBP; Myelin A1 protein; myelin basic protein; myelin basic protein Golli-mbp; myelin basic protein S; myelin deficient; myelin membrane encephalitogenic protein; Myelin P1 protein; myelin-associated oligodendrocyte basic protein; R75289; shi; shiverer; Unknown (protein for IMAGE:7984318); unnamed protein product
Mouse
Protein G
RUO
100063306, 17196, 24547, 414286, 4155, 618684
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Liquid
Suggestions de produits

Suggestions de produits

Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis