missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MEIS1 Polyclonal antibody specifically detects MEIS1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Spécification
Spécification
| Antigène | MEIS1 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | DyLight 550 |
| Formule | 50mM Sodium Borate |
| Alias de gène | homeobox protein Meis1, leukemogenic homolog protein, Meis homeobox 1, MGC43380, myeloid ecotropic viral integration site 1 homolog, myeloid ecotropic viral integration site 1 homolog (mouse) |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 300-390 of human MEIS1 (NP_002389.1).,, Sequence:, PSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?