missing translation for 'onlineSavingsMsg'
Learn More

MMAB Antibody, Novus Biologicals™

Code produit 18404961 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
25 μL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18404961 25 μL 25µL
18287726 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18404961 Fournisseur Novus Biologicals Code fournisseur NBP18660225ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

MMAB Polyclonal specifically detects MMAB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antigène MMAB
Applications Immunofluorescence, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Numéro d’ordre du gène Q96EY8
Alias de gène aquocob(I)alamin vitamin B12s adenosyltransferase, ATP:cob(I)alamin adenosyltransferase, ATP:corrinoid adenosyltransferase, ATR, cblB, c-diamide adenosyltransferase, mitochondrial, cob, Cob(I)alamin adenosyltransferase, cob(I)yrinic acid a, EC 2.5.1.17, methylmalonic aciduria (cobalamin deficiency) cblB type, methylmalonic aciduria (cobalamin deficiency) type B, Methylmalonic aciduria type B protein, MGC20496
Symboles de gène(s) MMAB
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:AFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL
Poids moléculaire de l’antigène 27 kDa
Méthode de purification Affinity Purified
Quantité 25 μL
État réglementaire RUO
Disciplines de recherche Proteases & Other Enzymes
Primaire ou secondaire Primary
Identification génétique (Entrez) 326625
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.