missing translation for 'onlineSavingsMsg'
Learn More

PAX7, Mouse, Clone: 3F10, Abnova™

Code produit. 16044495
Change view
Click to view available options
Quantité:
200 μL
Conditionnement:
200µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit. Quantité unitSize
16044495 200 μL 200µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit. 16044495 Fournisseur Abnova Code fournisseur H00005081M14A.200uL

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Mouse monoclonal antibody raised against a partial recombinant PAX7.

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: AYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISASCSQRADSIKPGD

Spécification

Antigène PAX7
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3F10
Conjugué Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PAX7.
Formule ascites with no preservative
Expression PAX7
Numéro d’ordre du gène NM_002584
Alias de gène HUP1/PAX7B
Symboles de gène(s) PAX7
Espèces hôtes Mouse
Immunogène PAX7 (NP_001128726.1,351 a.a. ∽ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantité 200 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 5081
Espèces cibles Human
Contenu et stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Type de produit Antibody
Forme Ascites
Isotype IgG2a κ
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.