missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MPPED1 Polyclonal antibody specifically detects MPPED1 in Human, Mouse, Rat samples. It is validated for Western Blot
Spécification
Spécification
| Antigène | MPPED1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formule | PBS (pH 7.3), 50% glycerol |
| Alias de gène | Adult brain protein 239, C22orf1MGC88045, chromosome 22 open reading frame 1, EC 3.1, FAM1AFLJ78907, FLJ50009, FLJ54633,239ABFLJ59965, metallophosphoesterase domain containing 1, metallophosphoesterase domain-containing protein 1 |
| Espèces hôtes | Rabbit |
| Immunogène | Recombinant fusion protein containing a sequence corresponding to amino acids 277-326 of human MPPED1 (NP_001037835.1). PRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS |
| Méthode de purification | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?