missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MRN Complex Interacting Protein Polyclonal specifically detects MRN Complex Interacting Protein in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spécification
Spécification
| Antigène | C5orf45 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gène | chromosome 5 open reading frame 45, DKFZp686L2452, hypothetical protein LOC51149, LOC51149, MGC65027, MGC78537 |
| Symboles de gène(s) | C5ORF45 |
| Espèces hôtes | Rabbit |
| Immunogène | This antibody was developed against a recombinant protein corresponding to the amino acids: KSQPSESRWLKYLEKDSQELELEGTGVCFSKQPSSKMEEPGPRFSQDLPRKRKWSGSTVQPPCSRGVQDSGGSEVAWGPQKGQAGLTW |
| Afficher plus |
For Research Use Only
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?