missing translation for 'onlineSavingsMsg'
Learn More

MYBPC2 Antibody, Novus Biologicals™

Code produit 18627518 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
25 μL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18627518 25 μL 25µL
18620866 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18627518 Fournisseur Novus Biologicals Code fournisseur NBP24877925ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

MYBPC2 Polyclonal antibody specifically detects MYBPC2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spécification

Antigène MYBPC2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formule PBS (pH 7.2), 40% Glycerol
Alias de gène C-protein, skeletal muscle fast isoform, fast MyBP-C, fast-type muscle myosin-binding-protein C, MGC163408, MYBPC, MYBPCF, myosin binding protein C, fast type, myosin-binding protein C, fast-type
Espèces hôtes Rabbit
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: FKGKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSEKKSDTA
Méthode de purification Immunogen affinity purified
Quantité 25 μL
État réglementaire RUO
Disciplines de recherche Cell Biology, Cytoskeleton Markers, Signal Transduction
Primaire ou secondaire Primary
Identification génétique (Entrez) 4606
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.