missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NFU1 iron-sulfur cluster scaffold homolog Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-48647-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
NFU1 iron-sulfur cluster scaffold homolog Polyclonal antibody specifically detects NFU1 iron-sulfur cluster scaffold homolog in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Spécification
| NFU1 iron-sulfur cluster scaffold homolog | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| CGI-33, mitochondrial, Nfu, NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDD | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 27247 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu