missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NGFI-B alpha/Nur77/NR4A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-68896
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
NGFI-B alpha/Nur77/NR4A1 Polyclonal antibody specifically detects NGFI-B alpha/Nur77/NR4A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spécification
| NGFI-B alpha/Nur77/NR4A1 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Early response protein NAK1, GFRP1ST-59, growth factor-inducible nuclear protein N10, HMRNP10, hormone receptor, MGC9485, N10, NAK1, NAK-1, NGFIB, Nuclear hormone receptor NUR/77, nuclear receptor subfamily 4 group A member 1, nuclear receptor subfamily 4, group A, member 1, NUR77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, steroid receptor TR3, Testicular receptor 3, TR3, TR3 orphan receptor | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS | |
| 100 μg | |
| Apoptosis | |
| 3164 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu