missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. NUDT8 Antibody, Novus Biologicals™

NUDT8 Antibody, Novus Biologicals™

Product Code. p-200041440 Shop All Bio Techne Products
Change view
Click to view available options
Quantité:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantité unitSize
18407100 25 μL 25µL
18259155 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18407100 Supplier Novus Biologicals Supplier No. NBP18190825ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NUDT8 Polyclonal specifically detects NUDT8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigène NUDT8
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène EC 3.6.1.-, FLJ41567, nucleoside diphosphate-linked moiety X motif 8, mitochondrial, nudix (nucleoside diphosphate linked moiety X)-type motif 8, Nudix motif 8
Symboles de gène(s) NUDT8
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:EVFALPLAHLLQTQNQGYTHFCRGGHFRYTLPVFLHGPHRVWGLTAVITEFALQLLAPGTYQPRLAGLTCSGAEGLARPKQPLASPCQASSTPGLNKGL
Méthode de purification Affinity Purified
Quantité 25 μL
État réglementaire RUO
Disciplines de recherche Lipid and Metabolism
Primaire ou secondaire Primary
Identification génétique (Entrez) 254552
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.