missing translation for 'onlineSavingsMsg'
Learn More
Learn More
O-GlcNAc Transferase p110 subunit Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-48598-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
O-GlcNAc Transferase p110 subunit Polyclonal antibody specifically detects O-GlcNAc Transferase p110 subunit in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spécification
| O-GlcNAc Transferase p110 subunit | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| EC 2.4.1, EC 2.4.1.255, FLJ23071, HRNT1, MGC22921, O-GLCNAC, O-GlcNAc transferase p110 subunit, O-GlcNAc transferase subunit p110, O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase), O-linked N-acetylglucosamine transferase 110 kDa subunit, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit, uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCY | |
| 25 μL | |
| Amino Acids Drugs and other smAll species molecules, Cellular Markers, Golgi Apparatus Markers, Stem Cell Markers | |
| 8473 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu