missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PACE4/PCSK6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Marque: Novus Biologicals NBP1-87354
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
PACE4/PCSK6 Polyclonal specifically detects PACE4/PCSK6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
| PACE4/PCSK6 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| EC 3.4.21, EC 3.4.21.61, EC 3.4.21.75, PACE4EC 3.4.21.-, Paired basic amino acid cleaving enzyme 4, paired basic amino acid cleaving system 4, proprotein convertase subtilisin/kexin type 6, SPC4subtilisin-like protease, Subtilisin/kexin-like protease PACE4, Subtilisin-like proprotein convertase 4 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 5046 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PCSK6 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKR | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu