missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PACRG Polyclonal antibody specifically detects PACRG in Human, Mouse, Rat samples. It is validated for Western Blot
Spécification
Spécification
| Antigène | PACRG |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formule | PBS (pH 7.3), 50% glycerol |
| Alias de gène | FLJ32724, Glup, HAK005771, Molecular chaperone/chaperonin-binding protein, PARK2 co-regulated, PARK2 coregulated gene protein, PARK2CRG, parkin coregulated gene protein, parkin co-regulated gene protein, RP3-495O10.2 |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human PACRG (NP_001073847.1). IIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPT |
| Méthode de purification | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?